Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Alpha-2,8-sialyltransferase 8B (Fragment)
  • GlycoProtDB:GPDB0001187
  • UniProt:A0A0A6YVX5
  • Gene Symbol: St8sia2
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
68 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MQLQFRSWMLAALTLLVVFLIFADISEIEEEIGAEVVINGSSPPAVADRSNESLKHNIQPASSKWRHNQTLSLRIRKQILKFLDAEKDISVLKGTLKPGDIIHYIFDRDSTMNVSQNLYELLPRTSPLKNKHFQTCAIVGNSGVLLNSGCGQEIDTHSFVIRCNLAPVQEYARDVGLKTDLVTMNPSVIQRAFEDLVNATWREKLL

Feature

GlyTouCan Images

No data