Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 (Fragment)
  • GlycoProtDB:GPDB0001193
  • UniProt:A0A0A6YW84
  • Gene Symbol: St6galnac6
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
12 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MSSNKTLPSRCNQCVIITSSSHLLGTKLGPEIERAECTIRM

Feature

GlyTouCan Images

No data