Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Antithrombin-III
  • GlycoProtDB:GPDB0001226
  • UniProt:A0A0A6YXS8
  • Gene Symbol: Serpinc1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
8 17406563
22823882
23002422
47 22823882
23002422
67 17406563
22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MTKLGACNDTLKQLMEVFKFDTISEKTSDQIHFFFAKLNCRLYRKANKSSDLVSANRLFGDKSLTFNESYQDVSEVVYGAKLQPLDFKVSCR

Feature

GlyTouCan Images

No data