Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Calponin-3 (Fragment)
  • GlycoProtDB:GPDB0001289
  • UniProt:A0A0G2JFC8
  • Gene Symbol: Cnn3
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
24 17406563
22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

XGMLAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVCLLVL

Feature

GlyTouCan Images

No data