Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Adhesion G protein-coupled receptor L4 (Fragment)
  • GlycoProtDB:GPDB0001312
  • UniProt:A0A0G2JGY1
  • Gene Symbol: Adgrl4
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
126 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MRLLPLLVGFSTLLNCSYTQNCSKTTCLPNAKCEVHNGVEACFCSQGYSGNGVTICEDIDECSESSVCGDHAVCENVNGGFSCFCREGYQTATGKSQFTPNDGSYCQESMNSNCHLEHACIAANINKTLKRIGPITEQTTLLQEIYRNSEAELSLMDIVTYIEILTESSSLLGHPNSTTSY

Feature

GlyTouCan Images

No data