Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Alpha-2-macroglobulin-P (Fragment)
  • GlycoProtDB:GPDB0001341
  • UniProt:A0A0N4SUX6
  • Gene Symbol: A2m
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
24 17406563
22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MVMVPSLLHAGTPEKGCLLFNHLNETVTVKVSMES

Feature

GlyTouCan Images

No data