Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: C-type lectin domain family 1 member A (Fragment)
  • GlycoProtDB:GPDB0001347
  • UniProt:A0A0N4SVE6
  • Gene Symbol: Clec1a
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
135 ---

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MQAKYSSTRDMLDDDDTTISLYSGTSTVTRRAEPRHSVFQFYQLSNIQQDSITEKDEKLGNMSRQLQSLQAQNRKLIETLQQVAVKLCRELYNKSGGHRCSPCPEKWKWYGDKCYQFYKESKNWQSCEYFCLADNATMLKISTQEELGSPAMAVAKPGCGQMGH

Feature

GlyTouCan Images

No data