Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Beta-mannosidase
  • GlycoProtDB:GPDB0001369
  • UniProt:A0A0R4J092
  • Gene Symbol: Manba
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
89 17406563
22823882
23002422
297 22823882
23002422
302 22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MHLHLLLILALFRAGCVVAGPSYSLSGSWRVSNGNGSLELPATVPGYVHSALHQHGLIQDPYYRFNDLNYRWISLDNWTYSTEFKIPFNLSEWQKVKLIFDGVDTVAEILFNNVTIGKTDNMFTGYSFDVTNVVKDVNSLKLQFRSAVQYAECQSKAHTSYRVPPECPPVEQKGECHVNFIRKAQCSFSWDWGPSFPSQGIWKDVRIEAYNIAHLDYLTFLPVYDNASQAWNIEIEASFDVASSKSVSGQVTVAIPQLKTQQTNDIELQQEQRIVKLLVKIRKDVAVETWWPRGHGNQTGYNMTILFALDGGLKIEKAAKVYFRTVQLIEEGIKGSPGLSFYFKINGLPIFLKGSNWIPADSFQDKVTSDRLQLLFQSVVDANMNTLRVWGGGIYEQDEFYALCDELGIMVWQDFMFASALYPTEPGFLASVRKEVTYQVRRLKSHPSIIIWSGNNENEVALSVNWFHVNPRDMKTYIDDYVTLYVKNIRKIVLSEDKSRPFIASSPTNGMKTMEEGWISYDPYSIQYGDIHFYNYADDCWNWKIFPKARLVSEYGYQSWPSFSTLEKVSSQEDWAYNSRFSLHRQHHEDGNHQMLHQVKMHFKLPQGTDPLRTFKDTIYLTQVMQAQCIKTETEFYLRSRSEIVDGKGHTMGALYWQLNDIWQAPSWASLEYGGKWKMLHYFARRFFAPLLPVGFEDEGVFYVYGVSDLHKDHHTQLTVRLHHWSSPKPLCSLVNSSIVVKAGEAVVLFQMPVSELLKRCRGCTRETCVVSFYFSTDKELFSPTNYHFLSSLKDAKGLLEANITVNISQKGNVFVFDLETSAVAPFVWLDVGSIPGRFSDNGFLMIRKKLSVLFYPWKPTSKSELQQAFSVTSLTDTY

Feature

GlyTouCan Images

No data