Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Carcinoembryonic antigen-related cell adhesion molecule 10
  • GlycoProtDB:GPDB0001384
  • UniProt:A0A0R4J0G1
  • Gene Symbol: Ceacam10
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
104 22823882
224 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MELASAHLHKGQVPWVGLLLTASLLTYWSPATTAQVTVEAVPPNVTADNNVLLLVHNLPQTLRVFYWYKGNSGAGHNEIGRFVTSINRSKMGLAHSGRETIYSNGSLFFQSVTKNDEGVYTLYMLDQNFEITPISVRFHVHPSLLPSLSPPTTGQVTVEAVRPNVAEGENVLLLVHNLPRTLRAIYWYRGTTAGERNEIARFITASNKIILGPAHSDREIIYNNGSLFFQGVTKNDEGAYALDMLFQNFDHTLMPVQFNVHAKKQ

Feature

GlyTouCan Images

No data