Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Biotinidase
  • GlycoProtDB:GPDB0001402
  • UniProt:A0A0R4J131
  • Gene Symbol: Btd
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
105 17406563
22823882
136 17406563
22823882
189 17406563
22823882
335 17406563
22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MRSRFMVCIMSGARTAPALFFLGCSALALGVSSASQEHREAEYYVAAVYEHPSVLSPNPLELVSRQEALELMKQNLDVYEQQVMAAAQKGVQIIVFPEDGIHGFNFTRTSIYPFLDFMPSPKLVRWNPCLEPFRFNDTEVLQRLSCMAIKGGMFLVANLGTKQPCLSSDPGCPQDGRYQFNTNVVFSDNGTLVDRYRKHNLYFEAAFDTPANVDLITFDTPFAGKFGVFTCFDILFFDPAVRLLRDFEVKHIVYPTAWMNQLPLLAAIEIQKAFATAFGVNVLAANIHHPTLGMTGSGIHTPLKSFWYHDMDDPKGHLIIAQVATNPQGLTGTGNTTSEMDPSHRKFLKILSGDPYCEKDAQEVHCDEAAKWNVNVPPTFHSEMMYDNFTLVPVWGTEGHLQVCSNSLCCHLLYERPTLSKELYALGVFDGLHTVHGTYYIQTCALVKCGGLGFDTCGQEITEAEGLFDFHLWGNFSTLYIFPLFLTSGMTLDTPDQLGWENDHYFLRKRGLSSGLVTAALYGRLYERK

Feature

GlyTouCan Images

No data