Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2
  • GlycoProtDB:GPDB0001405
  • UniProt:A0A0R4J190
  • Gene Symbol: Bst1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
59 22823882
23002422
185 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MAVQGGLLSLWLWLWLSLLTVLLGARARWTGEGTTPHLQSIFLGRCAEYTTLLSLGNKNCTAIWEAFKGVLDKDPCSVLPSDYDLFINLSRHPIPRDKSLFWENNHLLVMSYGENTRRLVALCDVLYGKVGDFLSWCRQENASGLDYQSCPTSEDCENNAVDSYWKSASMQYSRDSSGVINVMLNGSEPKGAYPTRGFFADFEIPYLQKDKVTRIEIWVMHDVGGPNVESCGEGSVKILEDRLEALGFQHSCINDYRPVKFLMCVDHSTHPDCIMNSASASMRRESASLHAIGDASLLISLLVALASSSQA

Feature

GlyTouCan Images

No data