Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Butyrophilin-like protein 10
  • GlycoProtDB:GPDB0001409
  • UniProt:A0A0R4J1C6
  • Gene Symbol: Btnl10
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
102 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MARAHPGDATLPSILVSFIFLQLLTSGNGKSDFLVLGPPHPLLAIVGQDKELPCKLSLNISAEGMELRWYRDKPSSVVHVYKNGEDVYDEQMVEYKGRTSFNGSHVARGEAAVKIHNVTVFDNGTYHCVFKEYTSHSQATLWLKVAGRGSSPRIRVTDTQDKGIRAECTSAGWYPEPKVEWLDLKGQPVSAESHFSVSASTGLVALLSIVTPQDTAVGGLTCSISNPLLPEQDTGFLAAVVKVSVSGAHTGNIGQSVQSHGSIIKSSESFSVKVP

Feature

GlyTouCan Images

No data