Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Arylsulfatase K
  • GlycoProtDB:GPDB0001420
  • UniProt:A0A0R4J1N2
  • Gene Symbol: Arsk
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
499 17406563
22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MPAMLLLLVSVVAALALAAPAPRTQKKRMQVNQAPNVVLVASDSFDGRLTFQPGSQVVKLPFINFMRAHGTTFLNAYTNSPICCPSRAAMWSGLFTHLTESWNNFKGLDPNYTTWMDIMEKHGYQTQKFGKVDYTSGHHSISNRVEAWTRDVAFLLRQEGRPIINLIPDKNRRRVMTKDWQNTDKAIEWLRQVNYTKPFVLYLGLNLPHPYPSPSSGENFGSSTFHTSLYWLEKVAYDAIKIPKWLTLSQMHPVDFYSSYTKNCTGKFTENEIKNIRAFYYAMCAETDAMLGEIILALHKLDLLQKTIVIYTSDHGEMAMEHRQFYKMSMYEASVHVPLLMMGPGIKANLQVPSVVSLVDIYPTMLDIAGIALPPNLSGYSLLTLLSNASANEQAFKFHRPPWILSEFHGCNANASTYMLRTGQWKYIAYADGASVQPQLFDLSLDPDELTNIATEFPEITYSLDQKLRSIVNYPKVSASVHQYNKEQFIMWKQSVGQNYSNVIAHLRWHQDWQRDPRKYENAIQHWLTAHSSPLASSPTQSTSGSQPTLPQSTSG

Feature

GlyTouCan Images

No data