Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Aminopeptidase N (Fragment)
  • GlycoProtDB:GPDB0001442
  • UniProt:A0A0U1RNS3
  • Gene Symbol: Anpep
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
38 17406563
22823882
23002422
71 17406563
22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MEQYNEINAISTACSSGLKECRDLVVELYSQWMKNPNNNTIHPNLRSTVYCNAIAFGGEEEWNFAWEQFRNATLVNEADKLRSALACSKDVWILNRYLSYTLNPDYIRKQDTTSTIISIASNVAGHPLVWDFVRSNWKKLFENYGGGSFSFANLIQGVTRRFSSEFELQQLEQFKADNSATGFGTGTRALEQALEKTRANIDWVKEN

Feature

GlyTouCan Images

No data