Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: 4F2 cell-surface antigen heavy chain (Fragment)
  • GlycoProtDB:GPDB0001450
  • UniProt:A0A0U1RP98
  • Gene Symbol: Slc3a2
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
166 ---

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MSQDTEVDMKDVELNELEPEKQPMNAADGAAAGEKNGLVKIKVAEDETEAGVKFTGLSKEELLKVAGSPGWVRTRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPVQRWWHKGALYRIGDLQAFVGRDAGGIAGLKSHLEYLSTLKVKGLVLGPIHKNQKDEINETDLKQINPTLGSQEDFKDLLQSAKKKSIHIILDLTPNYQGQNAWFLPAQADIVATKMKEALSSW

Feature

GlyTouCan Images

No data