Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Casein kinase I isoform gamma-1 (Fragment)
  • GlycoProtDB:GPDB0001463
  • UniProt:A0A0U1RQ81
  • Gene Symbol: Csnk1g1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
105 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

QKIGDTKRNTPIEALCENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFERKGYTFDYAYDWVGRPIPTPVGSVHVDSGASAITRESHTHRDRPSQQQPLRNQTTSSERRGEWEIQPSRQTNTSYLTSHLAADRHGGSVQVVSSTNGELNVDDPTGAHSNAPITAHAEVEVVEEANCLKMLNLWCCCFFKRKRKKTAQRHK

Feature

GlyTouCan Images

No data