Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: CD81 antigen (Fragment)
  • GlycoProtDB:GPDB0001491
  • UniProt:A0A140LJL0
  • Gene Symbol: Cd81
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
84 22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNALTTLTTTILRNSLCPSGGNILTPLLQQDCHQ

Feature

GlyTouCan Images

No data