Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Adhesion G protein-coupled receptor G3 (Fragment)
  • GlycoProtDB:GPDB0001549
  • UniProt:A0A1D5RLS0
  • Gene Symbol: Adgrg3
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
106 22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

XENWGSTVNACPRDKNIRSRGWTEPGALCPSPELKSPQMLSLHLACYSFPPNWSGSGICLGAGILRGSWELLDPCLQIPRQVMQGEDEPADGVRLPKSLFGALPGNRSAVRLAITVLDIGAGNVFKGPKLLEDKGSSVLNNRMVGLSVGQMHATGLSEPVEITFSHERQPPAMILKTGMHAQTGRPSCAIHVVYPTCTVVQGASTDGVDLPIT

Feature

GlyTouCan Images

No data