Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Cadherin-16 (Fragment)
  • GlycoProtDB:GPDB0001550
  • UniProt:A0A1D5RM27
  • Gene Symbol: Cdh16
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
39 ---

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

VVVSGVSEDPDLANRNGPYSFALGPNPTVQRDWRLQPLNDSHAYLTLALHWVEPGEYMVPVVVHHDTHMWQLQVKVIVCRCNVEGQCMRKVGRMKGMPTKLSAVGVLLGTLAAIGLTHSSHTQASFSFLCSRTWPWQGRTWISQQTACL

Feature

GlyTouCan Images

No data