Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Carboxylesterase 1C (Fragment)
  • GlycoProtDB:GPDB0001552
  • UniProt:A0A1D5RM42
  • Gene Symbol: Ces1c
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
128 17406563
22823882
23002422
158 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

ALSAHENVVVVTIQYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESSGGISVSVLLPLSWADDPVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIATLSQCNDTSSAAMVQCLRQKTESELLEISGKLVQYNISLSTMIDGVVLPKAPEEI

Feature

GlyTouCan Images

No data