Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Cadherin-16 (Fragment)
  • GlycoProtDB:GPDB0001555
  • UniProt:A0A1D5RMB7
  • Gene Symbol: Cdh16
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
60 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

TLPEDVKPGALVATLMATDADLEPAFRLMDFAIEEGDPEGIFDLSWEPDSDHVQLRLRKNLSYEAAPDHKVVVVVSNIEELVGPGPGPAATATVTILVERVVAPLKLDQESYETSIPVSTPAGSLLLTIQPSDPMSRTLSSL

Feature

GlyTouCan Images

Image?style=extended&format=png&notation=cfg
G02743FN

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G05637SS

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G07132SE

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G09351HG

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G13933DE

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G14795PD

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G17013IQ

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G18383ZI

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G20861AN

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G21125ID

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G21408ZT

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G24858KZ

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G28182LP

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G28589EC

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G30118JA

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G32553MK

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G32860DL

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G34421AJ

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G34549PZ

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G34807PD

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G37535BG

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G38034XB

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G38036OL

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G39448FX

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G43311WK

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G45336XP

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G45612OA

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G46804HY

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G46902RC

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G47513TC

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G48357SY

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G49680BM

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G52182RP

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G53133ZY

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G54675NM

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G55193JF

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G56185CU

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G58472BZ

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G58609GW

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G59405GS

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G61514UE

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G61885YO

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G63277QV

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G65814GR

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G65828YT

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G66107GL

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G66522JV

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G68466ND

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G68764CR

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G70280CS

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G74082KL

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G74132QK

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G74422LK

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G74485ID

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G75366RT

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G77994OH

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G78759ZW

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G78920EP

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G79655OZ

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G80324IX

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G83435EK

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G85523KA

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G88761JB

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G92463DS

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G92474WU

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G93858VJ

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G96950YI

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G98949DH

Image from GlyTouCan

Image?style=extended&format=png&notation=cfg
G99475XL

Image from GlyTouCan