Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: CD11b (Fragment)
  • GlycoProtDB:GPDB0001574
  • UniProt:A1E2I0
  • Gene Symbol: Itgam
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
129 17406563
22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

SHRIIGAHFSPGLQYFGQSLSGGKDLTMDGLMDLAVGAQGHLLLLRAQPVLRLEATMEFSPKKVARSVFACQEQVLKNKDAGEVRVCLRVRKNTKDRLREGDIQSTVTYDLALDPVRSRIRAFFDETKNNTRRRTQVFGLMQKCETLKLILPDCVDDSVSPII

Feature

GlyTouCan Images

No data