Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Alpha-2,8-sialyltransferase (Fragment)
  • GlycoProtDB:GPDB0001575
  • UniProt:A1E2I1
  • Gene Symbol: St8sia1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
2 17406563
22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

TNQTSASLFRRQMEDCCDPAHLFAMTKMNSPMGKSLWYDGELLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKMSGCARQIDEPNFVMRCNLPPLSSEYTRDVGSKTQLVTANPSIIRQRFENLLWSRKKFVDNMKIYNHSYIYMPAFSMKTGTEP

Feature

GlyTouCan Images

No data