Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Carboxypeptidase (Fragment)
  • GlycoProtDB:GPDB0001605
  • UniProt:A2A5J8
  • Gene Symbol: Ctsa
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
140 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MPGTALSPLLLLLLLSWASRNEAAPDQDEIDCLPGLAKQPSFRQYSGYLRASDSKHFHYWFVESQNDPKNSPVVLWLNGGPGCSSLDGLLTEHGPFLIQPDGVTLEYNPYAWNLIANVLYIESPAGVGFSYSDDKMYVTNDTEVAENNYEALKDFFRLFPEYKDNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLASYEQNDNSLVY

Feature

GlyTouCan Images

No data