Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: ATP-binding cassette sub-family A member 8-A (Fragment)
  • GlycoProtDB:GPDB0001613
  • UniProt:A2A6R7
  • Gene Symbol: Abca8a
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
57 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MVKREINVCQQTWALLCKNLLRKKRLKRDTFLRIMDRVSLVSYMTGRKILASPNEENMTELISMRFSDVVGVIFTNAYSYNLKFIKGARIPTIKEHQDHTAHCHSYGEIIYCGLSEFWRDGFVALQAAINAAII

Feature

GlyTouCan Images

No data