Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Amphoterin-induced protein 1 (Fragment)
  • GlycoProtDB:GPDB0001633
  • UniProt:A2AE38
  • Gene Symbol: Amigo1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
30 23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

XTIRCDTKQQGMTKVWVSPSNEQVLSQGSNGSVSVRNGDLFFKKVQVEDGGVYTCYAMGETFNETLSVELKVYNFTLHGHHDTLNTAYTTLVGCILSVVLVLIYLYLTPCRCWCRGVEKPSSHQGDSLSSSMLSTTPNHDPMAGGDKDDGFDRRVAFLEPAGPGQGQNGKLKPGNTLPVPEATGLFPPLCTPGWQTSEPMGSITRQ

Feature

GlyTouCan Images

No data