Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Anoctamin (Fragment)
  • GlycoProtDB:GPDB0001650
  • UniProt:A2AHK9
  • Gene Symbol: Ano3
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
111 17406563
22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

GAYKSSLPIKTHGPQNNRHLLYERWARWGMWYKHQPLDLIRMYFGEKIGLYFAWLGWYTGMLIPAAVVGLCVFFYGLVTMNESQVSQEICKATEVFMCPLCDKNCSLQRLNDSCIYAKVTYLFDNGGTVFFAIFMAIWAPGRICRSPFHTCCGLFETQDMNTSNIPQDPWLLIGQHMKEPV

Feature

GlyTouCan Images

No data