Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: CD82 antigen (Fragment)
  • GlycoProtDB:GPDB0001663
  • UniProt:A2AIJ2
  • Gene Symbol: Cd82
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
127 17406563
22823882
131 17406563
22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MGAGCVKVTKYFLFLFNLLFFILGAVILGFGVWILADKNSFISVLQTSSSSLQVGAYVFIGVGAITIVMGFLGCIGAVNEVRCLLGLYFVFLLLILIAQVTVGVLFYFNADKLKKEMGNTVMDIIRNYTANATSSREEAWDYVQAQ

Feature

GlyTouCan Images

No data