Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Beta-1,6-N-acetylglucosaminyltransferase A
  • GlycoProtDB:GPDB0001746
  • UniProt:A2IQH5
  • Gene Symbol: Gcnt2
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
315 23002422
389 23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MPPSVRYFFIVSVTTVIVFIVLYVLSFGGDQSYQKLNISDSVRLSQVCSSFIDGKSRFLWRNKLMIHEKPSCTEYVTQSHYITAPLSQEEVDFPLAYVMVIHHNFDTFARLFRAIFMPQNIYCVHVDEKATAEFKGAVEQLVSCFPNAFLASKMEPVVYGGISRLQADLNCIKDLSTSEVPWKYAINTCGQDFPLKTNKEIVQYLKGLKGKNLTPGVLPPAHAIGRTRYVHREHLSKELSYVIRTTALKPPPPHNLTIYFGSAYVALSREFANFVLRDPRAVDLLHWSKDTFSPDEHFWVTLNRIPGVPGSMPPNASWTGNLRAVKWMDMEAKHGGCHGHYVHGICIYGNGDLQWLINSQSLFANKFELNTYPLTVECLELRLRERTLNQSEIAIQPSWYF

Feature

GlyTouCan Images

No data