Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: A disintegrin and metallopeptidase domain 34
  • GlycoProtDB:GPDB0001755
  • UniProt:A2RSG8
  • Gene Symbol: Adam34
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
546 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MSGAKALVHKRNMFLKFCLWTMFFFSAWSSIGHAKYSSLPEVVTPLRVTVTRGNNISPGWLSYSLNIEGQRHIITMKPKKNLISRNFLLFTYSDQGDLLEEQPFVQNDCYYHGYVDEDPESLVIVNTCFGSLQGTLEINGTTYEIMPKSTTSTFEHLAYKMDNGESEPSPMRCGLSEEEIAQQMKLQESNASTLLQIPYENWWTHHRFIDYFVVIDHNRYVHRNNNTTTCIQDMLQVVNGINGYYLQIQTDVVLTKLEVWSQNNLINVEQEIRKVLGAFCNWKINAIGNRVRHDIIHLFVRRSYGTYLGLANVGTVCLTLNCAVNSFLSDSLSDMAFIIAHEMGHNLGMMHDGSSCTCGLSSCIMAPYKSNSPKFSNCSYEEMFSVVTKRSCLYDIPDALKTINLMPTMCGNNLVEEGEECDCGSTESCLQDPCCSSDCVLKPGAQCAFGLCCKNCQFLKTGTVCREEKNECDLPEWCNGTSAECPGDVYKADGIPCSGEGYCYKMECHQRDEQCRKIFGNGSRSADEICYMEMNRRGDRFGNCGNDSSMYRRCNLADVLCGRIQCENVIQLPQRRNHETVHYTHFSNVTCWTTDYHFGITIDDVGAVSDGTTCGPDYLCVHRKCVSKSVLVRNCTPQLCHMQGVCNNKDHCHCNNTWEPPDCQLRGHGGSIDSGPPPVPLSPSNWSMYFLAFIIMYVLGFIALYGIRELKKKS

Feature

GlyTouCan Images

No data