Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase-like protein MGAT4E
  • GlycoProtDB:GPDB0001798
  • UniProt:A6H684
  • Gene Symbol: Mgat4e
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
264 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MEGGLRTGRLPKAPELSLQSFPSEWSWVWTYPLFHKLAAFACHASQAWLTVGITSESREGPNGLLDTLASLYHTSSTSEQKQMTVLVHLADSDPTWLRRTIIRISSLYRSQILTGQLLLIHAPPDAYPAVNDAQNKVSRGQIYSKQNVDHAFLMSFATKLSTYFLLIEDNVFCAPNFVNHIRSKVGYRKPNTWVLLEFSNMGFLGKLLHSRDLPLLAHFLLLFHKERPLNWLLLHFRTLLGQQSSILCRPFLFYHRLTHLTFENKTLIGHEKDPPDPYTLSGTVYTDMRFSDTHSPQEAYTLDESFFWSYNVTTGNYLTVILNNPANLNRVQVRTGSITDGKYILEKGQVELGYDPEGTPPQCTSFTLLGRLVQGQMDQFILESIGYKVSCVKLAVNANQVGGLMIRHIYIWGENAKNRKDVQIDNDDDDDDDDYDDDS

Feature

GlyTouCan Images

No data