Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B (Fragment)
  • GlycoProtDB:GPDB0001827
  • UniProt:A8Y5H5
  • Gene Symbol: Mgat4b
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
95 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MGPLKGTGSRRPHCLLFSFPPNTWVTTRDQPQPQVVGKRTRDVVDIYQREFLALRDRLHAAEQESLKRSKELNLVLEEIKRAVSERQALRDGEGNRTWGRLTEDPRLKPWNVSHRHVLHLPTVFHHLPHLLAKESSLQPAVRVGQGRT

Feature

GlyTouCan Images

No data