Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: ATPase Na+/K+ transporting beta 1 polypeptide (Fragment)
  • GlycoProtDB:GPDB0001835
  • UniProt:B0LAB6
  • Gene Symbol: Atp1b1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
12 17406563
22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

YLQPLLAVQFTNLTVDTEIRVECKAYGENIG

Feature

GlyTouCan Images

No data