Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: 60S ribosomal protein L26 (Fragment)
  • GlycoProtDB:GPDB0001849
  • UniProt:B1ARA3
  • Gene Symbol: Rpl26
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
91 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MKFNPFVTSDRSKNRKRHFNAPSHIRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSK

Feature

GlyTouCan Images

No data