Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase (Fragment)
  • GlycoProtDB:GPDB0001859
  • UniProt:B1AS81
  • Gene Symbol: St3gal3
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
64 23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLHCRRCIIVGNGGVLANKSLGSRIDDYDIVIRLNSAPVKGFERDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEP

Feature

GlyTouCan Images

No data