Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Calsperin
  • GlycoProtDB:GPDB0001902
  • UniProt:B1Q2L7
  • Gene Symbol: Calr3
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
42 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MVSARALLWAICVLRVALATVYFQEEFLDGERWRNRWVQSTNDSQFGHFRVSSGKFYGHKEKDKGLQTTQNSRFYAISASFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPSDLDQKKMNGKSQYYIMFGPDICGFDIKKVHVILYFKNQYHENKKPIRCKVDGFTHLYTLILRPDLSYEVKVDGQSIESGSIEYDWNLTSLRKTEKTSLDSRDWDQVEGSKVQDWEKHFLDAGASKPSDWNSELDGDWLQKPPYEDGLKAEGIDKDVWLHQKMRPAGYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYAEKFGKATWGETKGPEKEMDAIQAKEEVKKAREEDEEDLLMGKFHRHNHLSRFHRQGEL

Feature

GlyTouCan Images

No data