Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: CD84 antigen
  • GlycoProtDB:GPDB0001933
  • UniProt:B2RU38
  • Gene Symbol: Cd84
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
143 17406563
22823882
23002422
144 23002422
147 17406563
22823882
23002422
198 23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MAQRHLWIWFLCLQTWSEAAGKDADPMVMNGILGESVTFLLNIQEPKKIDNIAWTSQSSVAFIKPGVNKAEVTITQGTYKGRIEIIDQKYDLVIRDLRMEDAGTYKADINEENEETITKIYYLHIYRRLKTPKITQSLISSLNNTCNITLTCSVEKEEKDVTYSWSPFGEKSNVLQIVHSPMDQKLTYTCTAQNPVSNSSDSVTVQQPCTDTPSFHPRHAVLPGGLAVLFLLILIPMLAFLFRLYKRRRDRIVLEADDVSKKTVYAVVSRNAQPTESRIYDEIPQSKMLSCKKDPVTTIYSSVQLSEKMKETNMKDRSLPKALGNEIVV

Feature

GlyTouCan Images

No data