Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: CRS1C-5 (Fragment)
  • GlycoProtDB:GPDB0001977
  • UniProt:B3VKY4
  • Gene Symbol: Defa29
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
47 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

LQDVAQRRFPWCRKCRVCQKCQVCQKCPVCPTCPLCPKQPLCEERQNKTAITTQAPNTQHKGC

Feature

GlyTouCan Images

No data