Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Aga protein
  • GlycoProtDB:GPDB0002024
  • UniProt:B7ZNK6
  • Gene Symbol: Aga
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
300 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MERKSNLSLLLLLLVLGMPLVRGSSPLPLVVNTWPFKNATEAAWWTLLSGGSALDAVENGCAVCEKEQCDGTVGFGGSPDEGGETTLDAMIMDGTAMDVGAVGGLRRIKNAIGVARRVLEHTTHTLLVGDSATKFAESMGFTNEDLSTKTSRDLHSDWLSRNCQPNYWRNVIPDPSKYCGPYKPSGFLKQSISPHKEEVDIHSHDTIGMVVIHKTGHTAAGTSTNGDSPIPGAGAYADDTAGAAAATGDGDTLLRFLPSYQAVEYMRGGDDPAIACQKVILRIQKYYPNFFGAVICASVNGSYGAACNKLPTFTQFSFMVSNSLHNEPTEKKVDCI

Feature

GlyTouCan Images

No data