Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Allergin-1
  • GlycoProtDB:GPDB0002036
  • UniProt:B7ZP19
  • Gene Symbol: Milr1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
68 22823882
23002422
113 23002422
123 23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MGDGDSPMCLSAVSFKGIRCWLDKLLLWALTISITLQNAAVDCTRVENNELPSPNLNSSMNVVRMGQNVSLSCSTKNTSVDITYSLFWGTKYLESKRRRGGAVDFHLRISNANESGPYKCKVNVSNLMKYSQDFNFTMARGRHKTQTNGSQAVPAVVKDTSTVWRKARHEEGTTWERRLRERTSPRVLEMRLHRTSCMSTPARLRQSNPRRYTMPLQSSRRWHPWKKKVVRMEKLITSTLNSPTEV

Feature

GlyTouCan Images

No data