Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: ASL1/Antrx2 fusion protein
  • GlycoProtDB:GPDB0002075
  • UniProt:C6EQH0
  • Gene Symbol: No data
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
50 23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MMILAQSCTEILELSPSSVCVGEKFQVVLTGRAVTSISHDGSVLCTFTANSTYTKSEKPVSIQPSSILCPAPVLNKDGETLEVSISYNDGKSAVSRSLTITATECTNGIAAIVAILVLLLLLGAALMWWFWPLCCKVVIKDPPPPPSAPMEEEEEDPLPNKKWPTVDASYYGGRGVGGIKRMEVRWGDKGSTEEGARLEKAKNAVVMVPEEEIPIPSRPPRPRPTHQAPQTKWYTPIKGRLDALWALIMKQYDRVSLMRPQEGDEGRCINFSRVPHQ

Feature

GlyTouCan Images

No data