Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: CSC1-like protein 2 (Fragment)
  • GlycoProtDB:GPDB0002155
  • UniProt:D3YYJ8
  • Gene Symbol: Tmem63b
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
15 17406563
22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MLPFLLATLGTAALNSSNPKDYCYSARIRSTVLQGLPFGGVPTVLALDFMCFLALLFLFSILRKVAWDYGRLALVTDADRLRRQERERVEQEYVASAMHGDSHDRYERLTSVSSSVDFDQRDNGFCSWLTAIFRIKDDEIRDKCGGDAVHYLSFQRHIIGLLVVVGVLSVGIVLPVNFSGDLLENNAYSFGRTTIANLKS

Feature

GlyTouCan Images

No data