Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Alpha-1-antitrypsin 1-1 (Fragment)
  • GlycoProtDB:GPDB0002164
  • UniProt:D3YZL0
  • Gene Symbol: Serpina1a
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
64 17406563
22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MTPSISWGLLLLAGLCCLVPSFLAEDVQETDTSQKDQSPASHEIATNLGDFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILE

Feature

GlyTouCan Images

No data