Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase C (Fragment)
  • GlycoProtDB:GPDB0002165
  • UniProt:D3YZM8
  • Gene Symbol: Mgat4c
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
78 22823882
84 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MLKFYQMKYIFQILDKMRCLRKRSTVSFLGVLVVFLLFMNLYIEDSYVLEGDKQLIRETSTHQLNSERYVHTFKDLSNFSGTINVTYRYLAATPLQRKRYLTIGLSSVKRKKGNYLLDTIKSIFEQSSYEELKEISVVVHLADFNSSWRD

Feature

GlyTouCan Images

No data