Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2
  • GlycoProtDB:GPDB0002211
  • UniProt:D3Z3V2
  • Gene Symbol: St3gal2
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
211 17406563
22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MKCSLRVWFLSMAFLLVFIMSLLFTYSHHSMATLPYLDSGALGGTHRVKLVPGYSGLQRLGKEGLLGRNCACSRCMGDASTSEWFDSHFDGNISPVWTRDNMNLPPDVQRWWMMLQPQFKSHNTNEVLEKLFQIVPGENPYRFRDPQQCRRCAVVGNSGNLRGSGYGQEVDSHNFIMRMNQAPTVGFEKDVGSRTTHHFMYPESAKNLPANVSFVLVPFKALDLMWIASALSTGQIRFTYAPVKSFLRVDKEKVQIYNPAFFKYIHDRWTEHHGRYPSTGMLVLFFALHVCDEVGSRCCLEQN

Feature

GlyTouCan Images

No data