Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: All-trans retinoic acid-induced differentiation factor
  • GlycoProtDB:GPDB0002255
  • UniProt:D3Z6U7
  • Gene Symbol: Atraid
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
20 22823882
23002422
80 22823882
98 22823882
109 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MQARCCLNQKGTILGLDLQNCSLKDPGPNFLQAYTAIIIDLQANPLKDDLANTFRGFTQLQTLILPQDVPCPGGSNAWDNVTSFKDKQICQGQRDLCNSTGSPEMCPENGSCASDGPGLLQCVCADGFHGYKCMRQGSFSLLMFFGILGSTTLAISILLWGTQRRKAKAS

Feature

GlyTouCan Images

No data