Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: 60 kDa heat shock protein, mitochondrial (Fragment)
  • GlycoProtDB:GPDB0002265
  • UniProt:D3Z7J9
  • Gene Symbol: Hspd1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
103 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MLRLPTVLRQMRPVSRALAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRR

Feature

GlyTouCan Images

No data