Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: CSC1-like protein 1 (Fragment)
  • GlycoProtDB:GPDB0002309
  • UniProt:E0CXM3
  • Gene Symbol: Tmem63a
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
28 22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MTSSPFLDPWPSKAVFVRERLGLGERPNDSYCYNSAKNSTVLQGVTFGGIPTVLLLDVSCFLFLILVFSIIRRRFWDYGRIALVSEAGSEARFQRLSSSSSGQQDFENELGCCPWLTAIFRLHDDQILEWCGEDAIHYLSFQRHIIFLLVVISFLSLCVILPVNLSGDLLGKDP

Feature

GlyTouCan Images

No data