Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: CD36 antigen variant (Fragment)
  • GlycoProtDB:GPDB0002340
  • UniProt:E7D893
  • Gene Symbol: Cd36
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
95 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

SSYGVLDIGKCKEGKPVYISLPHFLHASPDVSEPIEGLHPNEDEHRTYLDVEPITGFTLQFAKRLQVNILVKPARKIEALKNLKRPYIVPILWLNETGTIGDEKAEMFKTQVTGKIKLLGMVEMALLGIGVVM

Feature

GlyTouCan Images

No data