Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6
  • GlycoProtDB:GPDB0002346
  • UniProt:E9PUI0
  • Gene Symbol: St6galnac6
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
64 22823882
23002422
72 22823882
115 22823882
23002422
139 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MSSNKEQRSAVFVILFALITILILYSSNSANEVFHYGSLRGRTRRPVNLKKWSFSSAYFPILGNKTLPSRCNQCVIITSSSHLLGTKLGPEIERAECTIRMNDAPTSGYSADVGNKTTFRVVAHSSVFRVLRKPQEFVNRTPETVFIFWGPPNKMQKPQGSLLRVIQRAGLMFPNMEAYAVSPARMQQFDDLFRGETGKDREKSHSWLSTGWFTMVIAVELCDHVHVYGMVPPDYCSQRPRLQRMPYHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHPSWT

Feature

GlyTouCan Images

No data